General Information

  • ID:  hor001857
  • Uniprot ID:  P81277(23-53)
  • Protein name:  Prolactin-releasing peptide PrRP31
  • Gene name:  PRLH
  • Organism:  Homo sapiens (Human)
  • Family:  FMRFamide related peptide family
  • Source:  Human
  • Expression:  Medulla oblongata and hypothalamus.
  • Disease:  Diseases associated with PRLH include Precocious Puberty, Central, 1.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0031861 prolactin-releasing peptide receptor binding
  • GO BP:  GO:0001894 tissue homeostasis; GO:0002021 response to dietary excess; GO:0006112 energy reserve metabolic process; GO:0006629 lipid metabolic process; GO:0007186 G protein-coupled receptor signaling pathway; GO:0007631 feeding behavior; GO:0009749 response to glucose; GO:0032868 response to insulin; GO:0040014 regulation of multicellular organism growth; GO:0042755 eating behavior; GO:0043434 response to peptide hormone; GO:0045444 fat cell differentiation; GO:0048483 autonomic nervous system development
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SRTHRHSMEIRTPDINPAWYASRGIRPVGRF
  • Length:  31(23-53)
  • Propeptide:  MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRPRLTCFPLEGGAMSSQDG
  • Signal peptide:  MKVLRAWLLCLLMLGLALRGAA
  • Modification:  T31 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates prolactin (PRL) release and regulates the expression of prolactin
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  PRLHR
  • Target Unid:  P49683
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81277-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001857_AF2.pdbhor001857_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 420041 Formula: C160H251N55O43S
Absent amino acids: CKLQ Common amino acids: R
pI: 12.2 Basic residues: 8
Polar residues: 9 Hydrophobic residues: 8
Hydrophobicity: -95.16 Boman Index: -10453
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 53.55
Instability Index: 4922.9 Extinction Coefficient cystines: 6990
Absorbance 280nm: 233

Literature

  • PubMed ID:  NA
  • Title:  NA